Protein Info for Shewana3_3708 in Shewanella sp. ANA-3

Annotation: ATPase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details PF02518: HATPase_c" amino acids 313 to 415 (103 residues), 39.7 bits, see alignment E=3.1e-14

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 100% identity to shn:Shewana3_3708)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1K7 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Shewana3_3708 ATPase domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MVKILGTNLQAADQVALLRTLGLLLQIGLTLFAADTFGLSLQMEPLVHVFVLEVLYLSLT
LALRKPLFAKERGLFIALSLDTLFWISWLYFSGGATNAFISLLLLPIALAAVTLPIWAPW
SLTAISTLAYSLMIFTMPESQMHHHGMDMSSHYLGMWFNFVISALVLTTSVALIAKRMRR
QDAQLAYMREGQLRQEQLLALGTVSAQMAHQLATPLSTLRLLLDELRDEQPEPSVTVVEM
ETALGRCEHTLTELRLATESIRDRRQRPQKITELVAGLKQKTQLLMPQTELNWLITCAPQ
QLEEQQILTDMSLTPAIMALIENAARASAETLGVAQVDISLDSAPREGQIYLQIRDYGAG
IAPSLLPQLGTLLIESPKGLGVALLLSHASLERLGAELILANHPQGGTVAQIRFTLLQPN
VSATTTEAL