Protein Info for Shewana3_3696 in Shewanella sp. ANA-3

Annotation: histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 311 to 329 (19 residues), see Phobius details PF12974: Phosphonate-bd" amino acids 28 to 265 (238 residues), 123.9 bits, see alignment E=7.2e-40 PF02518: HATPase_c" amino acids 474 to 591 (118 residues), 56.6 bits, see alignment E=3.4e-19

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to shn:Shewana3_3696)

Predicted SEED Role

"Tetrathionate reductase sensory transduction histidine kinase" in subsystem Tetrathionate respiration

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1J5 at UniProt or InterPro

Protein Sequence (592 amino acids)

>Shewana3_3696 histidine kinase (RefSeq) (Shewanella sp. ANA-3)
MSCILSLMGLNLSYADEDITLNEFKVGVLANHGVLQAKQRWQPMMDYLSEKVPNSRFEVV
PVDFNGMRSQLLSHDLQFIVTNPGQYLHLSNNFPLSWLATMKSRKHQGSTFTIGATIIVR
ADSPIRSLQDLRGKNVVASDPQALGGYQAAMGLLHKMGYLPEQFFGDVRFLGFPLEPLIY
QVRDGNADAAIAPFCTLEEMIETGLINQVDYRVIHPTNPPGYDCEVSTQLYPNWSFAAAD
TVSPRITMQITRALFDLPADHAAAITADTLGWTAPVSQLKVIELFKELQLQGASPPLYQT
VYKWMEKNKEWGGVLLLIFIVSTIYHLWLEYKFRQKSEFLVSTERQLKDKALQLERLQSA
AILGEIGAGLAHELNQPIAAITQYSEGAMIQLERLGQDNPELYDILGKINAQSIRAGAVV
HRIRGLLKRRQAKAESLNVTLVVKEALALLRRELDRAEVQVTLQVEGHPFELMGDSVGLS
QMWVNLVKNSLDALEACKDNRARQLRIEIYYHSSEIKVLVIDNGEGLQRQASELMASFAS
TKDAGLGLGLAICKDVVSRHHGSIQIENCQQSTHARLPWQQGCVVTVVLPKG