Protein Info for Shewana3_3687 in Shewanella sp. ANA-3

Annotation: short-chain dehydrogenase/reductase SDR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01370: Epimerase" amino acids 9 to 170 (162 residues), 28.7 bits, see alignment E=2.2e-10 PF00106: adh_short" amino acids 9 to 192 (184 residues), 178.7 bits, see alignment E=2.4e-56 PF08659: KR" amino acids 9 to 165 (157 residues), 51.3 bits, see alignment E=3.4e-17 PF13561: adh_short_C2" amino acids 13 to 222 (210 residues), 131.4 bits, see alignment E=1e-41 PF13460: NAD_binding_10" amino acids 13 to 184 (172 residues), 27.6 bits, see alignment E=6.4e-10

Best Hits

Swiss-Prot: 33% identical to Y2266_STAAN: Uncharacterized oxidoreductase SA2266 (SA2266) from Staphylococcus aureus (strain N315)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3687)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1I7 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Shewana3_3687 short-chain dehydrogenase/reductase SDR (RefSeq) (Shewanella sp. ANA-3)
MTKPTQPLVVITGASSGIGAAIAKQFSAAGHPLLLLARRVEPMQALELPNSLAIGVDVTD
TDAIKAAINQAEAQFGPVGCLINNAGVMLLGQIDTQDPNEWSRMLNINVMGVLNGIHAVL
AGMKARKTGTIINISSVAGRKTFPNHAAYCATKFAVHALTENIREEVAMDDVRLITIAPG
AVETELLSHTTDDAIKAGYQDWKVQMGGVIAPENVAAAALFAWQQPQNVCVREIVLAPTR
QQP