Protein Info for Shewana3_3685 in Shewanella sp. ANA-3

Annotation: Sel1 domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF08238: Sel1" amino acids 68 to 100 (33 residues), 17.2 bits, see alignment (E = 3.2e-07) amino acids 142 to 176 (35 residues), 35.5 bits, see alignment 5.1e-13 amino acids 178 to 212 (35 residues), 27.8 bits, see alignment 1.5e-10 amino acids 251 to 279 (29 residues), 19 bits, see alignment (E = 8.3e-08) amino acids 321 to 352 (32 residues), 30.8 bits, see alignment (E = 1.6e-11) amino acids 417 to 432 (16 residues), 9.5 bits, see alignment (E = 8.6e-05)

Best Hits

KEGG orthology group: K07126, (no description) (inferred from 100% identity to shn:Shewana3_3685)

Predicted SEED Role

"TETRATRICOPEPTIDE REPEAT FAMILY PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1I5 at UniProt or InterPro

Protein Sequence (512 amino acids)

>Shewana3_3685 Sel1 domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MSLILIIIAFVVLFILFAKYQKKKIQAEALATGEPSALLNHGLTLINQGEVNSGLDYIQQ
AVDKGFAVAAIAMAELYSGRFPQVPADPKASEYWYRKAAEIDPQYLPMLTLTSLVASEAQ
TPEQLREQVEQLKASAEVGQVEFQYELAYLYLRQAFLDPDASQAIYWFEKAAAQGNQDAY
YHLGTLYWHDERVTPDYSKAREYFEKAVAAGDEHAKDNLGHMLASGQGGPKDLVRAEALL
SEYAAENDFRQYYLGKRFLYGEDFAVDYGKARHWLEKSCATDNVFAKLALAHLKLLDPQT
DDDYQQARTEFETLASQWQEEALFGLGKIYEEGLGVSRQPIKALMYYQLAAMSHISDYQD
AYEKLSKRLGTLEIREAQSLCNNFLHQHPIPDEQQTYYYLNQAEIYRKGEHPSREALQTA
ETWYRKAADLGSQDGMQALVDINRHESIDKPVQTYIWSSILLRNFGQYGMNSDQLLYQQQ
ALSRLTESELLYAQDEIERIETQLAPYLQSNE