Protein Info for Shewana3_3684 in Shewanella sp. ANA-3

Annotation: MscS mechanosensitive ion channel (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 20 to 64 (45 residues), 38 bits, see alignment 1.8e-13 PF00924: MS_channel_2nd" amino acids 114 to 177 (64 residues), 49.3 bits, see alignment E=6.5e-17 PF21082: MS_channel_3rd" amino acids 184 to 266 (83 residues), 40.9 bits, see alignment E=3.4e-14

Best Hits

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 100% identity to shn:Shewana3_3684)

Predicted SEED Role

"Mechanosensitive ion channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1I4 at UniProt or InterPro

Protein Sequence (278 amino acids)

>Shewana3_3684 MscS mechanosensitive ion channel (RefSeq) (Shewanella sp. ANA-3)
MITPGLDQELQQLQGVYQLITEFLVNYSFQLLGAALVFLLGLWVASKVSRLVAKQCEKHQ
IDITLSNFVSNLVRILIIVMVAIIALGKIGISVTPMVAAIGAASLGAGLALQGMLSNYAA
GVTIIVTRPFVVGNTIEIKGESGVVTRINLGMTILTNEEGEQISIPNKHIVGEILHNSFS
NKLVETQFNLSYNNDPEAAISLITELLSQNPNVSQDTTPNIGINGFNAIGIEIGVRYWVP
TQSYFQHKYKINLAIYNALKQAGIEMACPVREIHLQEK