Protein Info for Shewana3_3662 in Shewanella sp. ANA-3

Annotation: MSHA biogenesis protein MshM (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 278 to 299 (22 residues), see Phobius details PF13191: AAA_16" amino acids 22 to 156 (135 residues), 39.5 bits, see alignment E=1.3e-13 PF13401: AAA_22" amino acids 42 to 171 (130 residues), 112.5 bits, see alignment E=2.8e-36 PF09848: SLFN-g3_helicase" amino acids 48 to 139 (92 residues), 24.9 bits, see alignment E=1.8e-09

Best Hits

KEGG orthology group: K12283, MSHA biogenesis protein MshM (inferred from 100% identity to shn:Shewana3_3662)

Predicted SEED Role

"MSHA biogenesis protein MshM" in subsystem Mannose-sensitive hemagglutinin type 4 pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1G2 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Shewana3_3662 MSHA biogenesis protein MshM (RefSeq) (Shewanella sp. ANA-3)
MYLKHFGLSQTPFSLTPNTGFFFGLSPYVEALQVLQTALQTGEGFIKVTGEVGTGKTLIC
RKLINELPQGFHCAYLPNPYLTPAELRWAVANELGLKYTSEIDQQQLTGLIQQQLLALSA
HGHAIVLVLDEAQALPDESLEALRLFTNLETESRKLLQVVLFGQPELDERLKRQAFRQLR
QRITFSYSLRPLTWDETDAYIRYRLAVAGYAGQALFGPKLTRKIAEASRGIPRLINILAH
KALMLSFGEGATQVRMAHIKGAIQDTEDASRGSQRWPAYMAIALIACAAAIGALLFSGVN
LQQLWGGVA