Protein Info for Shewana3_3660 in Shewanella sp. ANA-3

Annotation: type II secretion system protein E (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 586 transmembrane" amino acids 430 to 447 (18 residues), see Phobius details PF05157: MshEN" amino acids 61 to 148 (88 residues), 67.1 bits, see alignment E=1.1e-22 PF00437: T2SSE" amino acids 178 to 561 (384 residues), 438.6 bits, see alignment E=1.5e-135

Best Hits

KEGG orthology group: K12276, MSHA biogenesis protein MshE (inferred from 100% identity to shn:Shewana3_3660)

Predicted SEED Role

"MSHA biogenesis protein MshE" in subsystem Mannose-sensitive hemagglutinin type 4 pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1G0 at UniProt or InterPro

Protein Sequence (586 amino acids)

>Shewana3_3660 type II secretion system protein E (RefSeq) (Shewanella sp. ANA-3)
MKPRLKMRLGDLLVQESIITEEQLQQALGEQRKTGHKLGRTLIELRSITETQLLQFLSQQ
LNLPLLDISKRPIPAEVVSLIPEVQARRFRALAVEDRGDTVLVAMSDPADLQALDHLENL
ITPKKLSVAVAPEQQLLQAFDNLYRRTDQIAQIAGKLEEEYAADQMFDLASLTSSDSDNE
TTVVKLLQSIFEDAVQMRASDIHIEPGEKALRIRQRIDGQLHETILNEVNIAAALVLRLK
LMAGLDISEKRLPQDGRFHMEIKGHKIDVRMSTMPIYHGESVVMRLLDQSAGLLTLNETG
MPPHILARIRKQIKRPHGMLLVTGPTGSGKTTTLYGILSELNTADRKIITVEDPVEYQLP
RINQVQVNHKIGLDFSNVLRTTLRQDPDIIMVGEMRDQETVEIGLRGALTGHFVLSTLHT
NDAVTSALRLLDMGAASYLVASALRVIIAQRLVRRVCHNCGVEYQPTAQEKAWLNSVSRQ
DFSSAKFRIGTGCQSCNGSGYRGRIGIFEILELDEKMIDAMRTGNPQDFARAALQSPNFT
PLAESALQYLSEGMTTIEEVAKLVEDVSESQVPLSRDIISQQGVEA