Protein Info for Shewana3_3652 in Shewanella sp. ANA-3

Annotation: methylation site containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 transmembrane" amino acids 26 to 49 (24 residues), see Phobius details PF07963: N_methyl" amino acids 20 to 44 (25 residues), 31.2 bits, see alignment (E = 5.5e-12) TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 22 to 44 (23 residues), 24.6 bits, see alignment (E = 8e-10)

Best Hits

KEGG orthology group: K10927, MSHA pilin protein MshD (inferred from 100% identity to shn:Shewana3_3652)

Predicted SEED Role

"MSHA pilin protein MshD" in subsystem Mannose-sensitive hemagglutinin type 4 pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1F3 at UniProt or InterPro

Protein Sequence (191 amino acids)

>Shewana3_3652 methylation site containing protein (RefSeq) (Shewanella sp. ANA-3)
MRINPRLFSISTSVKASSKAKQQGFTLIELVVGMLVIAIAIVMLSSMLFPQADRAAKTLH
RVKSAELAHSVMNEIWGKRYDQNTNANGGVPACGSPLGAPCSRVTNLGPSEWKWPDEGEG
RNDFNDVDDYHGLTQNATMLNSSQTYVEAYPNYQLSVSVAYGSAPNTKLVTINVTTPDNE
VITYNLVRSNY