Protein Info for Shewana3_3648 in Shewanella sp. ANA-3

Annotation: rod shape-determining protein MreB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 TIGR00904: cell shape determining protein, MreB/Mrl family" amino acids 9 to 340 (332 residues), 548.7 bits, see alignment E=2.3e-169 PF06723: MreB_Mbl" amino acids 11 to 339 (329 residues), 492.2 bits, see alignment E=1.4e-151 PF00022: Actin" amino acids 36 to 205 (170 residues), 35.2 bits, see alignment E=1.4e-12 PF00012: HSP70" amino acids 110 to 208 (99 residues), 47.9 bits, see alignment E=1.6e-16 PF14450: FtsA" amino acids 163 to 319 (157 residues), 41.2 bits, see alignment E=5.1e-14

Best Hits

Swiss-Prot: 90% identical to MREB_SALTI: Cell shape-determining protein MreB (mreB) from Salmonella typhi

KEGG orthology group: K03569, rod shape-determining protein MreB and related proteins (inferred from 98% identity to swd:Swoo_4402)

Predicted SEED Role

"Rod shape-determining protein MreB" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1E9 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Shewana3_3648 rod shape-determining protein MreB (RefSeq) (Shewanella sp. ANA-3)
MFKKLRGIFSNDLSIDLGTANTLIYVRDEGIVLNEPSVVAIRGERSSSGQKSVAAVGTEA
KQMLGRTPGNIQAIRPMKDGVIADFYVTEKMLQHFIKQVHNNSFFRPSPRVLVCVPVGAT
QVERRAIRESAMGAGAREVYLIEEPMAAAIGAGLPVSEATGSMVVDIGGGTTEVAIISLN
GVVYSSSVRIGGDKFDDAIINYVRRNYGSLIGEATAERIKHTIGTAYPGDEVLEIEVRGR
NLAEGVPRSFTLNSNEILEALQEPLSGIVSAVMVALEQSPPELASDISERGMVLTGGGAL
LRDLDRLLMQETGIPVMVADDPLTCVARGGGKALEMIDMHGGDLFSEET