Protein Info for Shewana3_3645 in Shewanella sp. ANA-3

Annotation: maf protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00172: septum formation protein Maf
  • amino acids 1 to 188 (188 residues), 190.1 bits, E=1.3e-60
• PF02545: Maf
  • amino acids 2 to 190 (189 residues), 203 bits, E=1.8e-64

Best Hits

Swiss-Prot: 97% identical to NTPPA_SHESM: dTTP/UTP pyrophosphatase (Shewmr4_3469) from Shewanella sp. (strain MR-4)

KEGG orthology group: K06287, septum formation protein (inferred from 100% identity to shn:Shewana3_3645)

MetaCyc: 54% identical to nucleoside triphosphate pyrophosphatase YhdE (Escherichia coli K-12 substr. MG1655)
Nucleotide diphosphatase. [EC: 3.6.1.9]; 3.6.1.9 [EC: 3.6.1.9]

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (7/7 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• dZTP biosynthesis (3/5 steps found)
• pyrimidine deoxyribonucleotides dephosphorylation (1/3 steps found)
• tunicamycin biosynthesis (2/9 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Pantothenate and CoA biosynthesis
• Purine metabolism
• Riboflavin metabolism
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.9

Sequence Analysis Tools

See A0L1E6 at UniProt or InterPro

Protein Sequence (194 amino acids)

>Shewana3_3645 maf protein (RefSeq) (Shewanella sp. ANA-3)
MNLVLASTSPRRKELLTHIGLGRAEFRFTQVAPDIDETPRAAELPRDYVQRLAAEKAQAG
LALCSGMSQPAVLGSDTIVVLENEILGKPVDEADAKRVLRALSGKAHTVMTAVALAKADH
TSVRLVETLVRFCVLSDADIDAYVASKEPMDKAGSYGIQGLGGCFVKSIEGSYSCVVGLP
LVETRELLSEAGIR