Protein Info for Shewana3_3638 in Shewanella sp. ANA-3

Annotation: ABC-2 type transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 47 to 67 (21 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details amino acids 262 to 286 (25 residues), see Phobius details amino acids 295 to 319 (25 residues), see Phobius details amino acids 326 to 346 (21 residues), see Phobius details amino acids 389 to 408 (20 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 47 to 397 (351 residues), 180.4 bits, see alignment E=5.5e-57 PF01061: ABC2_membrane" amino acids 256 to 370 (115 residues), 34.7 bits, see alignment E=1.4e-12

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to shn:Shewana3_3638)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1D9 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Shewana3_3638 ABC-2 type transporter (RefSeq) (Shewanella sp. ANA-3)
MAKLPSEQTHLNEPKPLNGAQNAAQPASSGIIALVRRELRALWRDPWQLALISYIPLLGI
LCLWWLFSAGLPRQLPVAIVDQDHSQLSRMLTRQLKANPVTEPRSFTDLPSAVAAMQQAQ
VYAVVVFPHDMKKDLLTGHKPTIDVRYNSQFLLVGKLLSSQIQLSLGDGLLQVAGLKQLM
TGTPKSQVAVNLSPVKSQTTALFNRNNNYIGFLVPPVLVALWQLLSMLVMANSLNRELHL
NAAQSEEGISNRLTEHFWPKVLAKILLFTPILMLQGGFILAWLYLYLALPFAGSLALLLV
AQLIMLLAVWSLVLFIFVLMRDSARVISFCTALFAPAFAFMGITFPTHEMPQLAQWWRLI
MPSSHYIESHVSVVSYGATWSTLAQQLSSYWGFIGLLPLIYLLAIKLLPMTVKAQAEAAE
YDAAPLPAKGQ