Protein Info for Shewana3_3637 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 123 to 127 (5 residues), see Phobius details amino acids 185 to 209 (25 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 259 to 283 (25 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 352 to 370 (19 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 21 to 368 (348 residues), 192.7 bits, see alignment E=1e-60 PF01061: ABC2_membrane" amino acids 221 to 336 (116 residues), 29.5 bits, see alignment E=5.5e-11

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to shn:Shewana3_3637)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1D8 at UniProt or InterPro

Protein Sequence (383 amino acids)

>Shewana3_3637 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MNLWQLVLTELKAIVSDKAIAVTLFGGVLFYSVLYPLPYLHQVPTEQQLIVVDLDHSSLS
RQLIRHADASAKIQVIGQVGSITEAKRFIETGKAHGLLVIPEGFRRDLLLGKGVTLSYGG
DASYFLIYSAVAEGLVSAGMDAGKQVQLIGMLAQGKNPKEAEQNLNSLHLNSVPAFNPSL
GYTPYVVPGLFLLILHQTLLIGTGILGAGQWRSRSYWQQVSPLQLVCGRILAFMLIYMVF
TSFYVGYCYHWYKVSIQASLGLVALWLLPFLLATAAAGVAMSTLFSRRDLPTQVLLLISM
PILFVSGFVWPIALIPEPLVLGSQIIPAVPAIMGMLELNQMGASWASVLPKWLQLWGLFV
LFLGLAILGIKRRARVLAELSTS