Protein Info for Shewana3_3634 in Shewanella sp. ANA-3

Annotation: amino acid permease-associated region (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 282 to 307 (26 residues), see Phobius details amino acids 329 to 347 (19 residues), see Phobius details amino acids 353 to 377 (25 residues), see Phobius details amino acids 389 to 407 (19 residues), see Phobius details amino acids 413 to 430 (18 residues), see Phobius details PF13520: AA_permease_2" amino acids 13 to 404 (392 residues), 99.4 bits, see alignment E=2.3e-32 PF00324: AA_permease" amino acids 17 to 404 (388 residues), 102.3 bits, see alignment E=2.8e-33

Best Hits

Swiss-Prot: 65% identical to PLAP_ECOLI: Low-affinity putrescine importer PlaP (plaP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to shm:Shewmr7_0492)

MetaCyc: 65% identical to putrescine:H+ symporter PlaP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-69

Predicted SEED Role

"Putrescine importer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1D5 at UniProt or InterPro

Protein Sequence (443 amino acids)

>Shewana3_3634 amino acid permease-associated region (RefSeq) (Shewanella sp. ANA-3)
MSQQNPGLKQSLSLWQVVVMGLAYLTPMAVFDTFGIVSEITSGHVATSYLLALAGILFTA
FSYGHLVRKYPYAGSAYTYAQKTFSPNVGFMVGWSSLLDYMFMPMINMLLAKIYLTAMFP
NVEPWIFIFGLVAVMTVLNLRGIDLVANFNGVIVFAQIAIILVFIGLMAHSLSLGEGEGV
IASVRPFYSEEISLAPLFTGATILCFSFLGFDGLSSLSEETKDAKRVIPRAIVLTALIGG
VIFVSVSYFLQLFFPDISRFQQLDAVLPEIALYVGGNLFQSVVLVATTIAVLASGMAAHA
GVARILYVMGRDNMLPNKGFGYIHPKWRTPAFNVILVGLLALSAVSFDLEMALALVNFGA
LVAFTFVNLSVIVQFYIKEKRNQSLKDHFQYFVLPLCGAATIGVLWINLEPQSLELGLIW
AAVGILYLALRSLRLRKAVELQN