Protein Info for Shewana3_3618 in Shewanella sp. ANA-3

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 PF12838: Fer4_7" amino acids 13 to 76 (64 residues), 30.3 bits, see alignment E=2.3e-10 amino acids 91 to 143 (53 residues), 27.4 bits, see alignment E=1.9e-09 PF13247: Fer4_11" amino acids 54 to 148 (95 residues), 74.9 bits, see alignment E=2.6e-24 PF13237: Fer4_10" amino acids 56 to 103 (48 residues), 28.3 bits, see alignment E=6.9e-10 PF00037: Fer4" amino acids 87 to 105 (19 residues), 26.4 bits, see alignment (E = 2.3e-09) PF12798: Fer4_3" amino acids 92 to 105 (14 residues), 14.4 bits, see alignment (E = 3e-05)

Best Hits

Swiss-Prot: 65% identical to PSRB_WOLSU: Polysulfide reductase chain B (psrB) from Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W)

KEGG orthology group: K04014, formate-dependent nitrite reductase, Fe-S protein (inferred from 98% identity to shm:Shewmr7_0508)

MetaCyc: 65% identical to polysulfide reductase beta subunit (Wolinella succinogenes)
RXN-8269 [EC: 1.12.98.4]

Predicted SEED Role

"polysulfide reductase, subunit B" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.98.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1C1 at UniProt or InterPro

Protein Sequence (188 amino acids)

>Shewana3_3618 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MTKRYVMVHDENKCIGCQACNVACRSENGVPEGVTRLQVRVEGPYGEMPHLHFKYHRVSC
QQCEDAPCVKVCPTGAAYVGEDGIVSIHGDKCVGCMYCVAACPYKVRFMNPETKVADKCN
FCKDTRLARGEEPACVTVCPTDALVFGDANDPQSEVAMLLNTKITYQDKTHLGTKPRVYR
VPTKRGGI