Protein Info for Shewana3_3614 in Shewanella sp. ANA-3

Annotation: cystathionine gamma-synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 62% identical to METB_ECOLI: Cystathionine gamma-synthase (metB) from Escherichia coli (strain K12)

KEGG orthology group: K01739, cystathionine gamma-synthase [EC: 2.5.1.48] (inferred from 100% identity to shn:Shewana3_3614)

MetaCyc: 62% identical to O-succinylhomoserine(thiol)-lyase / O-succinylhomoserine lyase (Escherichia coli K-12 substr. MG1655)
4.3.1.-; Cystathionine gamma-synthase. [EC: 2.5.1.48]

Predicted SEED Role

"Cystathionine gamma-synthase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48)

MetaCyc Pathways

aspartate superpathway (23/25 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
L-methionine biosynthesis II (5/6 steps found)
L-methionine biosynthesis I (4/5 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (6/10 steps found)
homocysteine and cysteine interconversion (1/4 steps found)
superpathway of L-cysteine biosynthesis (fungi) (2/6 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.48

Use Curated BLAST to search for 2.5.1.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1B7 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Shewana3_3614 cystathionine gamma-synthase (RefSeq) (Shewanella sp. ANA-3)
MTAGKLVTERQLATLAVRQGIESDTQYGAVVPPIYLSTNYAFDGHKNPREFDYSRSGNPT
RSILGDALAKLEKGATGVVTCTGMAAITLVTTLLGPDDLLVVPHDCYGGSYRLFTNLAKK
GQFKLLVVDQTDAQALEQAIAQQPKMVWIETPSNPLLRVVDIEAIAKASHAVGALVVVDN
TFLSPILQQPLLLGADIVIHSTTKYINGHSDVVGGAVIAKDPQLGETLHWWSNTLGLTGS
AFDSYQTLRGLRTLAVRIREHQSNAQRIVDVLTSSPVVSKVYYPGLADHPGHAIAAKQQK
GFGAMLSFELKGGEAEVVAFLDALSLFSVAESLGGVESLVAVPATMTHRAMEPQARFEAG
IKDTLLRLSVGIEDADDLVADIQAGLAAVAACQ