Protein Info for Shewana3_3597 in Shewanella sp. ANA-3

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 95 to 119 (25 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 327 to 350 (24 residues), see Phobius details amino acids 358 to 376 (19 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 320 (313 residues), 160 bits, see alignment E=1.2e-50 PF06779: MFS_4" amino acids 12 to 374 (363 residues), 48.6 bits, see alignment E=1.2e-16 PF00083: Sugar_tr" amino acids 39 to 177 (139 residues), 32 bits, see alignment E=9.9e-12

Best Hits

Swiss-Prot: 55% identical to YTBD_BACSU: Uncharacterized MFS-type transporter YtbD (ytbD) from Bacillus subtilis (strain 168)

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 100% identity to shn:Shewana3_3597)

Predicted SEED Role

"Putative drug efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1A0 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Shewana3_3597 major facilitator transporter (RefSeq) (Shewanella sp. ANA-3)
MPLALLALTLSAFAIGTTEFVIVGLIPTMAQDLQVSLPSAGLLVSLYALGVAVGAPVLTA
LTGHWNRKHVLLAVMTLFVSGNVLAWQAPSYETLIAARVITGLAHGVFFSIGSTIATGLV
PKEKAASAIAIMFTGLTVALVTGVPLGTYIGQSFGWQSTFLAVALLGLIALIGSAFLVPN
NLKQTRAASLLTQAKVLTEPRLLLVFAITAIGYGGTFVAFTFLAPILQQISGFDASAIGA
IMLVYGVSVAIGNIWGGKMADNMGPIKALTYIFTGLAAVLFIFHFTALNPITAVLTILVW
GAFAFGNVPGLQVYVVKLAETYAPTAVDVASGLNIAAFNIGIALGAWGGGLIVEQMGLMQ
TPLIGSLVVIAALLLTRLSGYLDTRTEPVDTSVDGVKQ