Protein Info for Shewana3_3587 in Shewanella sp. ANA-3

Annotation: multidrug efflux system protein MdtL (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 128 to 152 (25 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 357 to 380 (24 residues), see Phobius details PF07690: MFS_1" amino acids 10 to 344 (335 residues), 153 bits, see alignment E=1.5e-48 PF06609: TRI12" amino acids 25 to 174 (150 residues), 26.6 bits, see alignment E=3.3e-10 PF00083: Sugar_tr" amino acids 36 to 177 (142 residues), 41.7 bits, see alignment E=1.1e-14

Best Hits

Swiss-Prot: 100% identical to MDTL_SHESA: Multidrug resistance protein MdtL (mdtL) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K08163, MFS transporter, DHA1 family, multidrug resistance protein (inferred from 100% identity to shn:Shewana3_3587)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L190 at UniProt or InterPro

Protein Sequence (396 amino acids)

>Shewana3_3587 multidrug efflux system protein MdtL (RefSeq) (Shewanella sp. ANA-3)
MFRYLLCCFGLVLMYPTGIDMYLVGLPQIANQLGATEAQLHIAFSVYLAGMATTMLFAGS
LADRIGRKPITLFSALLFALASYFAARSQSSDLFLVARFVQGVGAGCCYVVAFAILRDAL
DDKRRAKVLSMVNGVTCIIPVIAPVIGHLIMLRFPWPSLFYTMAVMGLLVFGLCLFVLRE
TYSKASFHSQTLPRVQTESFKQGFFISRVVITTLGVTTILSYVNVSPMLIMGQMGFDRGQ
YSNTMAMTALVSMLASFSTPFLLNQFKEKSLILFSQTLFAAAALVFILTQLGWLGQLFNL
LGFGLVCSGFAIGFGVTMSQALSPFVARAGVASSLLGIAQVCTSALYIWVMGLLEVSAIN
ILLAILAVGALISITLMLAVPKLSEMVANEQIPESA