Protein Info for Shewana3_3586 in Shewanella sp. ANA-3

Annotation: DNA-binding transcriptional regulator YidZ (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00126: HTH_1" amino acids 10 to 68 (59 residues), 59.1 bits, see alignment E=5.1e-20 PF01022: HTH_5" amino acids 16 to 48 (33 residues), 22.6 bits, see alignment 1.1e-08 PF03466: LysR_substrate" amino acids 108 to 313 (206 residues), 41.2 bits, see alignment E=1.9e-14

Best Hits

Swiss-Prot: 65% identical to YIDZ_CITK8: HTH-type transcriptional regulator YidZ (yidZ) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3586)

Predicted SEED Role

"Putative LysR-family transcriptional regulator YidZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L189 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Shewana3_3586 DNA-binding transcriptional regulator YidZ (RefSeq) (Shewanella sp. ANA-3)
MSKSLSRLDLNLLFTFQLLSQERSVSKAAKKLNVTPSTVSKSLAKLRDWFDDPLFIKTPQ
GLQLTPLAQSMEQDLADWLQMGKQLMGKRGDDMAKGLSFELMLESPLSLIMLNQLTQAIY
QHYPDAKVKVRNWDYDSLEAIVRGEADMGFTGRESHPRSKESLDLLPYFIDFEVLFTDLP
RVYLRRDHPALQEEWNIDTFLKYPHINILWEKSETWALDDVLIELGLTRNIVLTLASFEQ
SLFVAAEPHHSMMAVAPQYCEQYARQLHPDLVSRSIPISGEYLDKLAIPFTLIWHKRNSH
NPKITWLRNRIKAIFQPQTQD