Protein Info for Shewana3_3569 in Shewanella sp. ANA-3

Annotation: MATE efflux family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 48 to 73 (26 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 318 to 340 (23 residues), see Phobius details amino acids 359 to 382 (24 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details amino acids 418 to 437 (20 residues), see Phobius details PF01554: MatE" amino acids 25 to 182 (158 residues), 97.5 bits, see alignment E=3.6e-32 amino acids 247 to 407 (161 residues), 86 bits, see alignment E=1.2e-28 TIGR00797: MATE efflux family protein" amino acids 30 to 410 (381 residues), 188.5 bits, see alignment E=9e-60

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3569)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L172 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Shewana3_3569 MATE efflux family protein (RefSeq) (Shewanella sp. ANA-3)
MKDRHGLLSAPIGRVLLNMSLPNLIGIMTILGFSLADTFFISQLGTEALAAISFTFPVTL
IISSIAIGIGAGVSTNLGRLIGSGNAPRAKVFLHDALLLTFILIASLSALGSIFIKPLFS
LLGANDTSLPLIHDYMMYWYVGAPLLVLLMVGNQGLRSTGDTRSPAMIMALAAIINLILD
PLLIFGIGPFPRLEIQGAAIATLFSWLIALSLSGYLLIIKRNMLEWAAFDIDRMRANWSK
LAHIAQPAALMNLINPLANAVIMAMLAHIDHSAVAAFGAGTRLESVLLIVVMALSSSLMP
FIAQNLGAGQTQRAKQALLLSLKFIFVFQTLLYIPLAFFAQPLAHLFSTDPQVLEWLSFY
ILVLPCAYGPLGIVIIFATALNAYHRPMSSLVINLCRLVLLMLPLAALGSYIDGVKGLLL
ALPITNLLMGIACYYLAQRICEPAKVTTADAI