Protein Info for Shewana3_3543 in Shewanella sp. ANA-3

Annotation: diguanylate cyclase with PAS/PAC sensor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 254 to 376 (123 residues), 36.2 bits, see alignment E=6.1e-13 amino acids 381 to 497 (117 residues), 45.1 bits, see alignment E=1e-15 PF13426: PAS_9" amino acids 274 to 367 (94 residues), 29.4 bits, see alignment E=2.4e-10 amino acids 388 to 489 (102 residues), 54.5 bits, see alignment E=3.6e-18 PF13188: PAS_8" amino acids 274 to 316 (43 residues), 15.8 bits, see alignment 3.3e-06 amino acids 381 to 431 (51 residues), 25.8 bits, see alignment 2.2e-09 PF00989: PAS" amino acids 382 to 487 (106 residues), 36 bits, see alignment E=1.9e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 497 to 655 (159 residues), 145.6 bits, see alignment E=1.2e-46 PF00990: GGDEF" amino acids 501 to 655 (155 residues), 163 bits, see alignment E=1.5e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3543)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L147 at UniProt or InterPro

Protein Sequence (659 amino acids)

>Shewana3_3543 diguanylate cyclase with PAS/PAC sensor (RefSeq) (Shewanella sp. ANA-3)
MSGKLRQLIGTLQQQSRSTVAKVLLIIGMFIGICITLVFLVYIQGNIFDGVRTYVRGEGL
WAKAQKDATFYLIHYSYNKNEVDYQRYLAATAVMLGDRQAREALLASPIDELKAKDGFIQ
GLNDERDTESLIWFFRHFNRTHYMQRAVEIWTLADERFNTMMLLADSMHDEVSQFGGSPP
DLSQYRQQLIQLNEELLSLEIEFSLVLSEGARWVKRITWLISLGVVLLFISIGILVSRQI
IRNIAKSEKQLLISESRFSSLKNSDTIGIISWQLDGTIHDANDHFLHMLGFDREDLAAGL
INWRSLTPPEFEARDNIAIAELIEIGHCHQYEKQLISKTGAHVPVMLGASFLNSSTQEGV
AYFMDLTSSKQAEDKLRLAATVFNASTDGIIITDPLMSIISINQAFTDITGLTEQSLHQD
ASRFINTGHPNEDAYQAMCNLLQQGEQWQGELIKETASGYLPLSVRINTVRNEHNRLTHF
VIVITDISERKAEEEHLRHIAHHDALTNLPNRVLFHTKLEQAIVHAQRSDGIFAILFLDL
DNFKPVNDEFGHDVGDKLLQEVAKRLTSSIRQIDTITRLGGDEFVILLEHLPNEESVPIL
IRKITQALTAPYIIHKHKLHIGVSIGSAIYPCHGIDAKSLINYADQAMYVVKKANKLVQ