Protein Info for Shewana3_3536 in Shewanella sp. ANA-3

Annotation: lysine exporter protein LysE/YggA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 65 (27 residues), see Phobius details amino acids 71 to 95 (25 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 208 to 233 (26 residues), see Phobius details PF01810: LysE" amino acids 16 to 229 (214 residues), 106.3 bits, see alignment E=7.1e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3536)

Predicted SEED Role

"Threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L140 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Shewana3_3536 lysine exporter protein LysE/YggA (RefSeq) (Shewanella sp. ANA-3)
MDVSLLVTLAVIHCVALVSPGPDFAIMVKIATSQPRNTAVATAAGISVAILAHTILSLTG
VSLVIKSSHTLYLLVQLLGASYLAWMGFGALKAAVAFFSKPKTVLNGEGADPSGFTTTAD
AGADTPMAGAVNTLSPKQGFMRGLYTNLLNPKALVFFLTLFSALITPSVTPVTKFAAALM
LFALSLLWFGFLALMLSKAKVQQKLQRLTPIIDGVIGVIFMSVAVAIVSSLLLA