Protein Info for Shewana3_3526 in Shewanella sp. ANA-3

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 598 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 258 to 282 (25 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 34 to 308 (275 residues), 151.3 bits, see alignment E=4.5e-48 PF00005: ABC_tran" amino acids 369 to 518 (150 residues), 117.6 bits, see alignment E=7e-38

Best Hits

Swiss-Prot: 50% identical to ATM1_ASPOR: Iron-sulfur clusters transporter atm1, mitochondrial (atm1) from Aspergillus oryzae (strain ATCC 42149 / RIB 40)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to shn:Shewana3_3526)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L130 at UniProt or InterPro

Protein Sequence (598 amino acids)

>Shewana3_3526 ABC transporter related (RefSeq) (Shewanella sp. ANA-3)
MRPTLYFEGPIDKLNWHVVKLLWPYLLEYKGRVALAMSCLIVAKLASVGLPFILKDLVDT
LDANKTAQALSVPIGLVLAYGAVRLLTVITGEIRDTLFGRVTERAIRRLGLAVFDHLHRL
DLDFHLERRTGGLSRDIERGTSGVSFLMRFMVFNIVPTLLEIAMVIGIFFFNYGIAFAAI
TFTSVMAYIWFSVVATEWRTEYVRDAAKADSLSNTRAIDSLLNYETVKYFNNEKYESDRY
DQALDQWEVAKRKNRLSLFALNGGQALIIALAMTAMMALAAYKVTNNEMTLGDFVLINAF
MMQLFMPLNFLGFVYREIRGALANIERMFSLLDKHPRIVDKPDAFDFEPKRGELSFEHVS
FSYDDRPILRNVSFKVTAGKKVAVVGDSGAGKSTLIKLLFRFYDVEQGRILIDGQDIRQL
TQDALRRAIAIVPQDTVLFNDSLVENIRYGRPDATDEEVRHAIKLAHLEHFIASLSQGWD
TKVGERGLKLSGGEKQRVAIARAILKGSPVLVFDEATSSLDSRSEQAILSALREVAKGHT
SLVVAHRLSTIVDADQIVVLSQGEIVEQGNHQSLLAQNGLYAKLWRIQNEQQQLSVEV