Protein Info for Shewana3_3504 in Shewanella sp. ANA-3

Annotation: yecA family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 PF03695: UPF0149" amino acids 10 to 177 (168 residues), 147.8 bits, see alignment E=2.1e-47

Best Hits

Swiss-Prot: 38% identical to Y3920_SERP5: UPF0149 protein Spro_3920 (Spro_3920) from Serratia proteamaculans (strain 568)

KEGG orthology group: K09895, hypothetical protein (inferred from 100% identity to shn:Shewana3_3504)

Predicted SEED Role

"FIG001590: Putative conserved exported protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L108 at UniProt or InterPro

Protein Sequence (191 amino acids)

>Shewana3_3504 yecA family protein (RefSeq) (Shewanella sp. ANA-3)
MATPPSLRIDSLKIALDAAEIGQHPVEVHGALVGLICGGVEQTGDLWIKPLFDLMNDGQP
LPAPLHQLVCELFQDSVARLGDFEFGFMPLLPEEEEPLSQRVEALSLWTQSFLTGIAIIQ
PKLNKASAEVREVIKDLAEIAQVEFDVADDEESETAYIELLEFVRIAAIMCYSEFGPEPS
HGEGDDPAVIH