Protein Info for Shewana3_3502 in Shewanella sp. ANA-3

Annotation: 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details PF01494: FAD_binding_3" amino acids 7 to 322 (316 residues), 106.1 bits, see alignment E=4.9e-34 PF01266: DAO" amino acids 8 to 39 (32 residues), 31.1 bits, see alignment (E = 3.8e-11) TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family" amino acids 8 to 397 (390 residues), 429.2 bits, see alignment E=6.8e-133 PF13450: NAD_binding_8" amino acids 11 to 39 (29 residues), 22.7 bits, see alignment (E = 2e-08)

Best Hits

Swiss-Prot: 54% identical to UBII_ECOLI: 2-octaprenylphenol hydroxylase (ubiI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3502)

MetaCyc: 54% identical to 2-octaprenylphenol 6-hydroxylase (Escherichia coli K-12 substr. MG1655)
2-OCTAPRENYLPHENOL-HYDROX-RXN [EC: 1.14.13.240]

Predicted SEED Role

"2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.13.240

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L106 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Shewana3_3502 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (RefSeq) (Shewanella sp. ANA-3)
MLSSQAYDIAIVGGGMVGLATAIGLAQANLNVVVIDAQSTQAVSGEPRLRVSAINKASQR
LLEHLGAWHYLDASRATPYQKMAVWDKDGFGKIAFDASSISEPSLGAIIENDAISYALAK
RASEFDNITHIENQRIERIAFGEREAWLTLANGADAEIESVSAALVIAADGANSWVREQC
KIPLTFWDYGHHAIVATIRSEMPHLATARQVFLQDGPLAFLPLYEDNLCSIVWSVPPERA
TELLEMTLDQFERNLTAAFDGRLGICKLESERHAFPLRMRYARHFARHRLVLAGDAAHTI
HPLAGQGVNLGFLDAASIIEVIGELHDTGKDIGDYAQLRALERWRKADAMEMIAAMEGFK
RLFEGSNPLKKAIRDLGLNLVDNVAGLKTVFMQQAMGNKSSLPKLCR