Protein Info for Shewana3_3485 in Shewanella sp. ANA-3

Annotation: MATE efflux family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 95 to 121 (27 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 190 to 215 (26 residues), see Phobius details amino acids 236 to 264 (29 residues), see Phobius details amino acids 274 to 276 (3 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details amino acids 386 to 406 (21 residues), see Phobius details amino acids 412 to 433 (22 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 20 to 418 (399 residues), 168.8 bits, see alignment E=8.6e-54 PF01554: MatE" amino acids 20 to 180 (161 residues), 99.6 bits, see alignment E=7.7e-33 amino acids 247 to 404 (158 residues), 75 bits, see alignment E=2.9e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3485)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0Y9 at UniProt or InterPro

Protein Sequence (453 amino acids)

>Shewana3_3485 MATE efflux family protein (RefSeq) (Shewanella sp. ANA-3)
MAKSAKTLQQRMGIVALTWPIFIETLLQSLLGISDIFMLSHYSDNAVAAVGLTTQLMFFM
MVMSMMVSTGASILISQNNGAGQTQQATDIGVASVALSLGLAVVMGASMFFGAHGIISLF
ALEPEVAGYGNDYLLICGSLSIGLVMNIAFAAILRSYGFTRSAMLVTSSTGLMNVLGNYI
ALYSPFGLPVYGVTGVAISTVTSQIIGALIMLAVIRHKGIPLPMLRLKLLPRSTYWSVMR
IGLLNAGEMLSYNVAQMTIIYFISQMGTLSLTAYTYGLNISRFIYCFAVALGQAAQIQTG
YYVGKQWFDEITGRVQKYCLVGFITSLAIVLVFYWQRFTIVGWLSENPEVIQLTALLLLG
SIALETGRVFNLVIISALKGAGDVAFPVRVGLFSMWGIGVLLAWFFGLHLGYGVLAAWLA
VAADEWVRGLIMVHRWRSGRWQRFTRIPPATPI