Protein Info for Shewana3_3472 in Shewanella sp. ANA-3

Annotation: TonB-dependent siderophore receptor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 653 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07715: Plug" amino acids 51 to 156 (106 residues), 86.6 bits, see alignment E=1.6e-28 PF00593: TonB_dep_Rec_b-barrel" amino acids 231 to 618 (388 residues), 125 bits, see alignment E=7.7e-40

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to shn:Shewana3_3472)

Predicted SEED Role

"TonB-dependent receptor; Outer membrane receptor for ferrienterochelin and colicins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0X6 at UniProt or InterPro

Protein Sequence (653 amino acids)

>Shewana3_3472 TonB-dependent siderophore receptor (RefSeq) (Shewanella sp. ANA-3)
MGTHPTKIALLIGSLCSFSVIAPAVAADDASVAKVDEHIVVIGRSDKTPLNIAANVNVID
AAAIEQSGATSLTEVLRGQSGIQLSDNNIGTSFAMRGFSASSAVNNTLILLDGRRLNNID
IAAPSLNAIPLNLIERVEILSGSAGVLYGDQAVGGVINIVTKSPENTGGSVQLSGGSFNT
YEGRGDVSGAINKDWHYFLTGSYNQGDNYRKHNANETGSILGRIQYKTATDSFFVETSYY
DDDRENPGALTPKQFKENPRQSSNSSEYVHEMTTAARSGYQHQLNQNWALAADLDYSDTL
VSSLNWGAGSHNTRSLLMFSPKALANYSTRQGELNLVTGLDISRGKAEFDSMARSNVQEM
QSAYLQATVPLSHTLSYVVGGRYARVTDDLVDGNVYPNGIDLDEDATAFEFGLNYRPSAE
HRFYLRGDENFRFAKVDEQAYTPKDVYGLKPQTGRSYEAGWDWTVASQSLRVSLYRLDLE
DEIVFDPSAEKPVGGSFQGANVNADASRRYGASADWDWQVTQALTLGLEYNYIDAEFTDG
VNDGKQLSWVAEHTGRGYVSMDFAEHFQVFAEAIYTGDRFIEGDNANQGDKLSSYVLGNL
ALNYTRDAWLASLRIDNLFDKEYVSSGYYAGGEYDGYYTGRGRDIRLTVGYRF