Protein Info for Shewana3_3462 in Shewanella sp. ANA-3

Annotation: alpha/beta hydrolase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20434: BD-FAE
  • amino acids 80 to 176 (97 residues), 48.4 bits, E=1.3e-16
• PF00135: COesterase
  • amino acids 80 to 185 (106 residues), 28 bits, E=1.7e-10
• PF07859: Abhydrolase_3
  • amino acids 92 to 299 (208 residues), 197.7 bits, E=3.2e-62

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3462)

Predicted SEED Role

"5'-methylthioadenosine phosphorylase (EC 2.4.2.28) / putative esterase" in subsystem Methionine Salvage (EC 2.4.2.28)

MetaCyc Pathways

• S-methyl-5'-thioadenosine degradation II (1/1 steps found)
• 5'-deoxyadenosine degradation I (1/3 steps found)
• L-methionine salvage cycle III (6/11 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.28

Sequence Analysis Tools

See A0L0W6 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Shewana3_3462 alpha/beta hydrolase domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MQVSPRGTASAKLTDFLELANQNIALAKQQNIQYSPQLLRENLNKLAALMSAKPEVSYIA
DKAWQVKDAQHGDREIGCRVYSPAPNKALPVVLHFHGGGHMCGSVELYDPICRHLASIAQ
CVVISVEYRLAPEHPYPAGLEDCEYALRHYQSVLTEVQYQQGVSIMGDSAGGALCTSLSQ
RSLSDSTLNIAKQILVYPSVDYTMASASYQSNGAGFLLETPRVQWYFEQYFQEVAKDAER
VKQASPLHGEFNAKLPSTLIFTAGCDPLRDEGIAYANALTAAGVQVQHHQFEDMIHAYML
LQDLVTEECLATYRMIAAFLAEPITATSR