Protein Info for Shewana3_3453 in Shewanella sp. ANA-3

Annotation: peptidase M50 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 144 to 173 (30 residues), see Phobius details amino acids 185 to 202 (18 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 340 to 358 (19 residues), see Phobius details PF02163: Peptidase_M50" amino acids 162 to 235 (74 residues), 45.5 bits, see alignment E=3e-16 amino acids 242 to 277 (36 residues), 27.9 bits, see alignment 7.3e-11

Best Hits

KEGG orthology group: None (inferred from 99% identity to shm:Shewmr7_0672)

Predicted SEED Role

"Zn-dependent protease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0V7 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Shewana3_3453 peptidase M50 (RefSeq) (Shewanella sp. ANA-3)
MELLKIDCLGKSLRLEGSLAGWQQLFWDNTLVSQKAASVENGGLKVHEFELTQHQSQLAS
DTGETQVLEHKIQVRLETDVVWQPFRFDYRLLVDEEVIAQGTRTEKDIERQTPEVPVTNP
QKISFVGLASLGFKLLKSAKVIKVVLAGASVAAYSWLFSFQFALALIACLVFHEYGHIRA
MKYFGMKTKGIYLIPFMGGLALSDEKINTRWQDVVISIMGPTFGLLMSIGSLIAYHMTDN
VFFAGLAAFNALLNLFNLLPILPLDGGHILKSISFSMNSIMGLIACVIGAAFGVYISYTL
GLALLGFLLLIGSLEIVFEWRTRHQSHLLPLDRYGQIFSTIWYLVTVAALVGIIWHLAGT
GDDMLSLPLHILRS