Protein Info for Shewana3_3447 in Shewanella sp. ANA-3

Annotation: 16S rRNA m(2)G 1207 methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 PF08468: MTS_N" amino acids 17 to 175 (159 residues), 168.6 bits, see alignment E=2.8e-53 PF05175: MTS" amino acids 183 to 348 (166 residues), 191.9 bits, see alignment E=1.8e-60 PF06325: PrmA" amino acids 214 to 284 (71 residues), 27.9 bits, see alignment E=4.1e-10 PF13649: Methyltransf_25" amino acids 216 to 288 (73 residues), 29.6 bits, see alignment E=2.3e-10

Best Hits

Swiss-Prot: 100% identical to RSMC_SHESA: Ribosomal RNA small subunit methyltransferase C (rsmC) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 100% identity to shn:Shewana3_3447)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52)" (EC 2.1.1.52)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.172

Use Curated BLAST to search for 2.1.1.172 or 2.1.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0V1 at UniProt or InterPro

Protein Sequence (353 amino acids)

>Shewana3_3447 16S rRNA m(2)G 1207 methyltransferase (RefSeq) (Shewanella sp. ANA-3)
MPALIFYGSHAVLTNPSQVIIRNQETLSQHRVLVLNHEADSLPKALLDVAQSVDALALDY
HHYLHLAPQANAKLRCYFGHQLPHQDKYDTVIVYFPKAKPLAPYLFNLAAQHLVADGQLL
VVGENKGGVKSLVKLLPKYFATGVKLDNARHCLLFGSSLIDTAPEIKLSDWTSQYQLSTP
QGNITICNLVGVFSEKHLDQGTELLLSHLPTLSGRVLDFGCGAGVIAAALLKAQPTLSLE
CIDINAMALASCELTLAANGMTAKVYPSDGLAQTSGKFDGIISNPPFHDGLASTTSIAQR
FVADSAKQLQSKGIWQIVTNRHLPYSDTIAAEFGQLTVPAENNKYKLYSFQQA