Protein Info for Shewana3_3442 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF10263: SprT-like" amino acids 51 to 146 (96 residues), 78.1 bits, see alignment E=4.6e-26 PF17283: Zn_ribbon_SprT" amino acids 159 to 197 (39 residues), 30.8 bits, see alignment 2.5e-11

Best Hits

Swiss-Prot: 45% identical to SPRT_PASMU: Protein SprT (sprT) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K02742, SprT protein (inferred from 100% identity to shn:Shewana3_3442)

Predicted SEED Role

"Protein sprT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0U6 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Shewana3_3442 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MFNQRSLLNSLRRKAISSTSITSATAANSATPQRQPKPLTPLQQQILVRIEDCYQQAEIY
FKRPFARPLTQFTLRGRSAGTAHLQQNRLRFNPVLLRENSEAFLAEVVPHEISHLLCFQL
FGKTKPHGREWQSIMLKLFKVSPNTTHSFDTQSVKGKDFEYRCACGPVKLSIRRHNKVLR
GETRYLCKRCHTHLTFIEAAE