Protein Info for Shewana3_3436 in Shewanella sp. ANA-3

Annotation: elongation factor G (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 697 TIGR00484: translation elongation factor G" amino acids 2 to 688 (687 residues), 957.8 bits, see alignment E=3e-292 PF00009: GTP_EFTU" amino acids 6 to 277 (272 residues), 202.5 bits, see alignment E=1.5e-63 TIGR00231: small GTP-binding protein domain" amino acids 6 to 176 (171 residues), 91.9 bits, see alignment E=3.9e-30 PF22042: EF-G_D2" amino acids 308 to 388 (81 residues), 55.2 bits, see alignment E=1.8e-18 PF03144: GTP_EFTU_D2" amino acids 320 to 387 (68 residues), 63.4 bits, see alignment E=6.7e-21 PF14492: EFG_III" amino acids 400 to 473 (74 residues), 98.6 bits, see alignment E=5.1e-32 PF03764: EFG_IV" amino acids 475 to 594 (120 residues), 146.3 bits, see alignment E=1.1e-46 PF00679: EFG_C" amino acids 596 to 682 (87 residues), 95 bits, see alignment E=7.1e-31

Best Hits

Swiss-Prot: 99% identical to EFG2_SHESR: Elongation factor G 2 (fusA2) from Shewanella sp. (strain MR-7)

KEGG orthology group: K02355, elongation factor G (inferred from 99% identity to shm:Shewmr7_3324)

Predicted SEED Role

"Translation elongation factor G paralog" in subsystem Translation elongation factor G family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0U0 at UniProt or InterPro

Protein Sequence (697 amino acids)

>Shewana3_3436 elongation factor G (RefSeq) (Shewanella sp. ANA-3)
MTELSKYRNIGIFAHVDAGKTTTTERILKLTGKIHKLGEVHDGESTTDFMVQEAERGITI
QSAAVSCFWKDHRFNVIDTPGHVDFTVEVYRSLKVLDGGIAVFCGSGGVEPQSETNWRYA
NESEVARIIFVNKLDRMGADFLRVVKQTKDVLAANPLVMVLPIGIEDEFTGVVDLLTRKA
YVWDDSGIPENFTVTDVPADMVDQVEEYREMLIESAVEQDDDLLEAYMEGEEPSIEDLKR
CIRKGTRTMAFFPTFCGSAFKNKGMQLVLDAVVDYLPAPDEVDPQPLTDEEGNETGEYAI
VSADESLKALAFKIMDDRFGALTFVRIYAGRLKKGDTILNSATGKTERIGRMCEMYANDR
IEIESAEAGDIIAIVGMKNVQTGHTLCDVKHPCTLEAMVFPEPVISIAVAPKDKGGSEKM
AIAIGKMIAEDPSFRVETDEDSGETILKGMGELHLDIKVDILKRTYGVELIVGEPQVAYR
ETITQMVEDQYTHKKQSGGSGQFGKIEYIIRPGEPNSGFVFKSSVVGGNVPKEYWPAVEK
GFASMMNTGTIAGFPVLDVEFELTDGAYHAVDSSAIAFEIAAKAAFRQSIAKAKPQLLEP
IMKVDVFSPEDNVGDVIGDLNRRRGMIKDQVAGVTGVRVKADVPLSEMFGYIGSLRTMTS
GRGQFSMEFSHYSPCPNSVSDKVVEQVKERKAAEAKK