Protein Info for Shewana3_3431 in Shewanella sp. ANA-3
Name: napG
Annotation: quinol dehydrogenase periplasmic component (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 54% identical to MAUM_PARDP: Methylamine utilization ferredoxin-type protein MauM (mauM) from Paracoccus denitrificans (strain Pd 1222)
KEGG orthology group: K02573, ferredoxin-type protein NapG (inferred from 100% identity to shn:Shewana3_3431)Predicted SEED Role
"Ferredoxin-type protein NapG (periplasmic nitrate reductase)" in subsystem Nitrate and nitrite ammonification
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0L0T5 at UniProt or InterPro
Protein Sequence (244 amino acids)
>Shewana3_3431 quinol dehydrogenase periplasmic component (RefSeq) (Shewanella sp. ANA-3) MSQQVKSPFTVKQVNRRQFLATTAKAGCVMGLVGLGLTATAKSQGQLAPQACRPPGALEE SDFLSACVRCGLCVEACPYDTLSLARWFDGAATGTPFFTARRIPCEMCEDIPCIKACPSG ALDPQLEQISDAKMGVAVLIDEKNCLNFKGLRCDVCYRVCPLIDNAITLERQRNQHSDHH AMFLPTVNSDTCTGCGKCEHACVLDTAAIKVLPTTLALGKAAAHDTYINTEETTLEMLNK GLTL