Protein Info for Shewana3_3424 in Shewanella sp. ANA-3

Annotation: methylation site containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 5 to 28 (24 residues), 38.7 bits, see alignment 2.8e-14 PF07963: N_methyl" amino acids 5 to 28 (24 residues), 36.1 bits, see alignment 3.4e-13 PF16732: ComP_DUS" amino acids 29 to 107 (79 residues), 65.2 bits, see alignment E=7.9e-22

Best Hits

KEGG orthology group: K02655, type IV pilus assembly protein PilE (inferred from 98% identity to shm:Shewmr7_3312)

Predicted SEED Role

"Type IV pilus biogenesis protein PilE" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0S8 at UniProt or InterPro

Protein Sequence (123 amino acids)

>Shewana3_3424 methylation site containing protein (RefSeq) (Shewanella sp. ANA-3)
MSALRKGFTLIELMIAVAIIGILAAIAIPSFNEYLKQGRRFDAQQYLVSSAQALERHYSR
NGLYPASQSLTNNAYYSFSYTPTTDKLGFSLKAVPTSRQSDSCGTLSLDHKGVRAPATHC
WTH