Protein Info for Shewana3_3413 in Shewanella sp. ANA-3

Annotation: curlin-associated protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF07012: Curlin_rpt" amino acids 81 to 114 (34 residues), 31.9 bits, see alignment (E = 5e-12) amino acids 125 to 158 (34 residues), 36.4 bits, see alignment (E = 2e-13) amino acids 169 to 208 (40 residues), 30.2 bits, see alignment 1.8e-11 amino acids 220 to 254 (35 residues), 35.4 bits, see alignment 4.1e-13 amino acids 243 to 277 (35 residues), 36.4 bits, see alignment 2e-13 amino acids 314 to 347 (34 residues), 36.4 bits, see alignment (E = 2e-13) amino acids 358 to 391 (34 residues), 46.6 bits, see alignment (E = 1.3e-16) amino acids 380 to 405 (26 residues), 26.3 bits, see alignment (E = 2.8e-10) amino acids 459 to 492 (34 residues), 32.8 bits, see alignment (E = 2.6e-12)

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3413)

Predicted SEED Role

"Minor curlin subunit CsgB, nucleation component of curlin monomers" in subsystem Curli production

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0R7 at UniProt or InterPro

Protein Sequence (502 amino acids)

>Shewana3_3413 curlin-associated protein (RefSeq) (Shewanella sp. ANA-3)
MKSQAKKSLIALAIATGLSGQAFAASLINDISVEQTGQGQDTLVAQTGLINAAAVTQTGN
DQVATVLQDGVWHEAQVNSTGDANHVTVTQQTDWHVASVNVTGNNNEAEVAQDGFFNQSS
NDITGNDNLVSVNQLGEVNESYVEITGNENSAFVEQEGDANLAVFRVQGDNNDGDIKQYG
SNNQAGLIALDLTANVGNNNDVSVEQIGNNNFGAAKGIAGNDNSVDIYQKGESHTGFVYA
LGGSENDITMKQEGSSNTAYLSMTTGDDNSIDIAQDGNRNTVGDTLVADIQGNDNDITIK
QRGDSNGAEFQVWGDSNDVDLKQRGDANFATFGAYGTDNDFDLSSKGDNNELVAFATGED
NSIEISQEGDTNFAYVDAVGNDNEVDVEQDGDQNETIISVTGNNNADVTALQHRGDLNLI
DLIIEGDENSAQITQAGNGNWVGGDSGTSFASSSFGVRGDNNSLMITQTGNDNLVVGSQA
GNSNSISVNQSGDMNVATVVQY