Protein Info for Shewana3_3378 in Shewanella sp. ANA-3

Annotation: Na(+)-translocating NADH-quinone reductase subunit A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 TIGR01936: NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit" amino acids 9 to 456 (448 residues), 557.5 bits, see alignment E=1.1e-171 PF05896: NQRA_N" amino acids 9 to 101 (93 residues), 133.3 bits, see alignment E=5.9e-43 PF13375: RnfC_N" amino acids 25 to 90 (66 residues), 29.5 bits, see alignment E=1.3e-10 PF24836: NQRA_2nd" amino acids 122 to 265 (144 residues), 205.6 bits, see alignment E=7.8e-65 PF11973: NQRA_SLBB" amino acids 270 to 318 (49 residues), 72.5 bits, see alignment 6.6e-24

Best Hits

Swiss-Prot: 61% identical to NQRA_PSEHT: Na(+)-translocating NADH-quinone reductase subunit A (nqrA) from Pseudoalteromonas haloplanktis (strain TAC 125)

KEGG orthology group: K00346, Na+-transporting NADH:ubiquinone oxidoreductase subunit A [EC: 1.6.5.-] (inferred from 100% identity to shn:Shewana3_3378)

MetaCyc: 59% identical to Na(+)-translocating NADH-quinone reductase subunit A (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit A (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0N2 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Shewana3_3378 Na(+)-translocating NADH-quinone reductase subunit A (RefSeq) (Shewanella sp. ANA-3)
MADFSNQVITIKKGLDLPISGEPRQIIEPGNRPSQVALLGEEYVGLKPTMLVEVGDKVKK
GQPLFEDKKTKGVLFTAPASGEIVAIHRGERRVLQSVVIRCNGLDADEQIRFDIHTDLQA
LSADVVKAQLVKSGLWTALRTRPFSRVPALDSKPAGIFVTAMDTNPLAADPRLIIAEQRD
AFKAGLAVLSHLTEGKVYLCQDKGEALVGADLPKVEVRRFTGVHPAGLAGTHIHFTLPVS
IERQVWHIGYQDVIAYGKLFQTGELYTDRVVALGGPSVLNPRLLRTQLGAELSALVADEV
KPGNNRVVSGSVLSGHTARGVHDFLGRFHNQVSVLAEDVQHQVLPWVRGGSDKFSITRAV
TSRLFGLTKSFEFTTHQGGSHRAMMAFGQLDRVMPLDILPTLLVRDLVVRDTDEAQALGA
LELDEEDLALCTFVCPGKYDFGKELRACLDVIEREG