Protein Info for Shewana3_3361 in Shewanella sp. ANA-3

Annotation: protein of unknown function DUF306, Meta and HslJ (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03724: META" amino acids 31 to 134 (104 residues), 96 bits, see alignment E=6.8e-32

Best Hits

KEGG orthology group: None (inferred from 99% identity to she:Shewmr4_0765)

Predicted SEED Role

"Protein of unknown function DUF306"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0L6 at UniProt or InterPro

Protein Sequence (138 amino acids)

>Shewana3_3361 protein of unknown function DUF306, Meta and HslJ (RefSeq) (Shewanella sp. ANA-3)
MLKQTFLLSALLFGLTACQSTDVANQDTVPLQGSWHIEAVQGQPTVDYSPAQITFADEGK
LSGNNSCNNFFGQYSQQGQALKIIPGGSTMKACVDALMQQEHKVMQALPLVAKAKLVQGR
LTLLSSDDKPVLVLSQLK