Protein Info for Shewana3_3340 in Shewanella sp. ANA-3

Annotation: putative PAS/PAC sensor protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 744 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details PF21623: HK_sensor_dom_bact" amino acids 87 to 292 (206 residues), 33.5 bits, see alignment E=3.9e-12 PF00989: PAS" amino acids 360 to 459 (100 residues), 28.2 bits, see alignment E=2.4e-10 PF13426: PAS_9" amino acids 364 to 460 (97 residues), 23.4 bits, see alignment E=9.1e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3340)

Predicted SEED Role

"sensory box protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0J5 at UniProt or InterPro

Protein Sequence (744 amino acids)

>Shewana3_3340 putative PAS/PAC sensor protein (RefSeq) (Shewanella sp. ANA-3)
MLKKNPSLHPLAPLLSLTQGLHWSHQRLLAVASQLSMLVIGMIILTNLIITLGERRLQEE
WATQRYSELQTIGTLITDKVAFQQFRTQLFAKDELLKQYLKNPTASSQQKLQESWQELVQ
HIPELLGIALFDPQGNYKFATPSNFSQDALPAALLGSSRNLGGKEVFTSPLEFVPLNGML
EPYMYQMTWLEKPDQSSLGYLITYNSIVQMLEAIKPAFSSNKSPMLVLDTQGLLYAGVSE
LAPLTHIPDTLGASLRQSYPALWREMSMSNFGQFHGEDATFVYLKVELTNQPELRREYFL
LSYIRNADIASKFSQWQNIVIVAALILTLLAAWVILLSHMYRLQYRSRQYSIDVANALFN
NDIGFILANEQARIISANPKAAEATQVPQDELTDRSLQRALNLDDLTHAQMLDQVHRQGE
WQGKLSLDNDKGSRLSVCVRQAPRLGRGLPHLLVSLEDISAMIDCQNQAFLSDLLCDTTV
ATALTDANGKLIKINPVFDQLMQLNGDLNHDLASLLANDLGNQWQRITAQISMQGQWQGQ
ILCSPNLRHSNCLQATLKGHVAADGEIDYIICTLEQAADNLRGAEPRSFVPHRSTILQHL
ADLERYFASLSPQSRNHSSLLVMDINPEGLLSHMSDIDQLETRQQEVEVQLLLEIPTHYQ
ILHWQLGKLLLLLPDTDATAAHHFALNTIEKLNSNGLGEGISIGIASYQEGQSLEQYLSN
AEVALKRAKQNNDQNIGQAFTRQP