Protein Info for Shewana3_3335 in Shewanella sp. ANA-3

Annotation: multi-sensor hybrid histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1122 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 240 to 265 (26 residues), see Phobius details PF03707: MHYT" amino acids 75 to 131 (57 residues), 71.2 bits, see alignment 2.9e-23 amino acids 138 to 185 (48 residues), 55.3 bits, see alignment (E = 2.7e-18) amino acids 208 to 255 (48 residues), 24.6 bits, see alignment (E = 1.1e-08) TIGR00229: PAS domain S-box protein" amino acids 276 to 402 (127 residues), 91.5 bits, see alignment E=2.2e-30 amino acids 406 to 529 (124 residues), 39.9 bits, see alignment E=2e-14 PF00989: PAS" amino acids 280 to 391 (112 residues), 51.1 bits, see alignment E=6.3e-17 PF08448: PAS_4" amino acids 288 to 395 (108 residues), 28.8 bits, see alignment E=6.4e-10 PF13426: PAS_9" amino acids 290 to 394 (105 residues), 32.7 bits, see alignment E=3.7e-11 amino acids 427 to 521 (95 residues), 21.5 bits, see alignment E=1.1e-07 PF08447: PAS_3" amino acids 432 to 515 (84 residues), 54 bits, see alignment 8.6e-18 PF00512: HisKA" amino acids 543 to 607 (65 residues), 70.7 bits, see alignment 4.4e-23 PF02518: HATPase_c" amino acids 655 to 769 (115 residues), 102 bits, see alignment E=1.3e-32 PF00072: Response_reg" amino acids 791 to 904 (114 residues), 75.9 bits, see alignment E=1.4e-24 PF01627: Hpt" amino acids 949 to 1023 (75 residues), 32.5 bits, see alignment 4.3e-11

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to shn:Shewana3_3335)

Predicted SEED Role

"Related to two-component system sensory/regulatory protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0J0 at UniProt or InterPro

Protein Sequence (1122 amino acids)

>Shewana3_3335 multi-sensor hybrid histidine kinase (RefSeq) (Shewanella sp. ANA-3)
MGLEHMAFDWLSQFFIFSHDSLLLNVYYNPLLVTISILIAIFAAFMAFQVTTQAVQSQSR
ARQQSMLLTGSLVLGGGVWSMHFIGMLAFDLCSPVSYDFGLTALSLLPCIGASWVALNLL
SKPSFQFSQVLLSGTLVGAGIGTMHYVGMAAMEMAPLLRYDPWIFALSIVVAVLLAIIAL
WVRTGLNQLISSNMSTITSNFIASIVMGLAISGMHYTGMAAARFVRPEGLELSQQTSEIS
FYLALGVSVITTAIICLVLIVNVIFKYKDLSLLAKSNEDRMRAMMNTAVDGIITIDGQGI
IVNVNKAVTTILGWSPAELLGANVKKIVPEAIRPHHDGYLARYAQTREAQIIGTGREVEA
QHKAGHLVPVRLSIGHVMQGKAHYFVGFISDLSQRNEMEQELKINEAKFRSLITNIPGIA
YRCKSTEGWPMVFISDAVQNITGYPAEDFELPHPKRFFSDLYHPDDIETIYAQAQPPTFS
MEYRIIRADGGVRWLFEHGNYILDETSKEVWIDGFLMDITERKEMEQDLVTAKNNAEQAA
AARAAFLANMSHEIRTPMNAIIGFSDILLESVLDLEQQKQLSTINRSAKSLLHLLNDVLD
SAKLDKGKLELENRVFCLTDEIDTVISTLWLQAKKQRLSLEVDVAPTMAANFIGSPERIR
QVLINLIGNAVKFTCEGTVTVRVFPQDTTQDTTKITFEIIDTGIGMSPEQLNRVFEAFAQ
ADASMSRKYGGTGLGTTISKQLVELMGGELTAESTLGQGSTFRFTIPLQPSSEPLSTQRA
DNGSLPPLTLLVVDDIQQNIDLLSVWLTRQGHKVITARDGEQALLRMQKADIDITLMDLQ
MPVMDGLTAAKMRREQEAESQLPHMPIIALTASVLEQDKSAAEQAGMDGFANKPIDFALL
TREIARVLQLNPPQAEFESLPPVSTLLVDEAKGVKLWGSKPLFIKELMKFIAQWPEKSQA
LQQAMSGQDTATIKLLSHSLKGVSGNLGLLQWMAHFGQLEQLAQAESPSREAMEAIVAQI
SDSLVEIGDYIESTTVPAAAVSAAVHAGTGDPAQLLTHIDALLASIAHHSFEESDLEALT
ARIDESLRLRAAIIAEALDNFDFDIAHNELTELRRFITANKE