Protein Info for Shewana3_3334 in Shewanella sp. ANA-3

Annotation: response regulator receiver modulated metal dependent phosphohydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF00072: Response_reg" amino acids 12 to 121 (110 residues), 85.2 bits, see alignment E=5.3e-28 PF13487: HD_5" amino acids 146 to 310 (165 residues), 128.5 bits, see alignment E=3.5e-41 PF01966: HD" amino acids 156 to 278 (123 residues), 75 bits, see alignment E=9e-25

Best Hits

KEGG orthology group: K07814, putative two-component system response regulator (inferred from 100% identity to shn:Shewana3_3334)

Predicted SEED Role

"Response regulator receiver:Metal-dependent phosphohydrolase, HD subdomain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0I9 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Shewana3_3334 response regulator receiver modulated metal dependent phosphohydrolase (RefSeq) (Shewanella sp. ANA-3)
MQSTSEHKKTLLLVDDEPVNLRVLKQVLHQDYHLIFAKSGEEALRLAQTELPSLILLDIM
MPNMTGLEVCQLLKNISETQSIPVIFVTALNDEHDEAAGFAVGGVDYIVKPISATIVKAR
VKTHLSLVQADELRRTRLQVIQRLGRAAEYKDNETGTHVLRMSHYSKILALAYGLSEAQA
DDLLHAAPMHDIGKIGIPDSIMLKPGKLTDEEFAIMKTHPHIGAEIIGEADSELLRLAKS
VALTHHEKWNGTGYPNGLKGEAIPLEGRIVALADVFDALTSKRPYKEAWSVEKTMDYIHE
QSGVHFDPELVRLFTDNLDKVLEIKNKWIDS