Protein Info for Shewana3_3333 in Shewanella sp. ANA-3

Annotation: methyltransferase small (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF01596: Methyltransf_3" amino acids 19 to 109 (91 residues), 28.4 bits, see alignment E=3.9e-10 PF03602: Cons_hypoth95" amino acids 29 to 118 (90 residues), 41.9 bits, see alignment E=3.6e-14 PF05175: MTS" amino acids 34 to 123 (90 residues), 47.4 bits, see alignment E=7.2e-16 PF13847: Methyltransf_31" amino acids 34 to 113 (80 residues), 37.2 bits, see alignment E=1e-12 PF06325: PrmA" amino acids 35 to 112 (78 residues), 31 bits, see alignment E=7.3e-11 PF13649: Methyltransf_25" amino acids 38 to 131 (94 residues), 40.2 bits, see alignment E=1.9e-13 PF08241: Methyltransf_11" amino acids 39 to 120 (82 residues), 29.2 bits, see alignment E=4.7e-10 PF01170: UPF0020" amino acids 52 to 185 (134 residues), 24.3 bits, see alignment E=9.2e-09

Best Hits

Swiss-Prot: 100% identical to TRMN6_SHESA: tRNA1(Val) (adenine(37)-N6)-methyltransferase (Shewana3_3333) from Shewanella sp. (strain ANA-3)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3333)

Predicted SEED Role

"tRNA (adenine37-N(6))-methyltransferase TrmN6 (EC 2.1.1.223)" (EC 2.1.1.223)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.223

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0I8 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Shewana3_3333 methyltransferase small (RefSeq) (Shewanella sp. ANA-3)
MAFTFKQFHIDDLNCGMPVSTDGVILGAWAPLSRAKHILDIGAGSGLLSLMAAQRSQGQI
TAVELEEKAAAACQYNMTQSPWADRCKLIHGDIQHVCQQAEYQEYFDHIICNPPYFEHGP
KANEQHRAMARHTDTLGFTPLLEAISQCLSHEGHASLILPIQSLTRFKACLHQTQLYLVK
EVRVKSMENKDANRVLLLLAKILLTQSQDEPCQHTELTLRGEDGRYTEQMIALTKDFYLK
L