Protein Info for Shewana3_3332 in Shewanella sp. ANA-3

Annotation: branched-chain amino acid transport system II carrier protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 131 to 148 (18 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details amino acids 322 to 343 (22 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 383 to 401 (19 residues), see Phobius details amino acids 439 to 458 (20 residues), see Phobius details PF05525: Branch_AA_trans" amino acids 10 to 457 (448 residues), 463.9 bits, see alignment E=2.9e-143 TIGR00796: branched-chain amino acid transport system II carrier protein" amino acids 15 to 445 (431 residues), 411.4 bits, see alignment E=2.2e-127

Best Hits

KEGG orthology group: K03311, branched-chain amino acid:cation transporter, LIVCS family (inferred from 100% identity to shn:Shewana3_3332)

Predicted SEED Role

"Branched-chain amino acid transport system carrier protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0I7 at UniProt or InterPro

Protein Sequence (467 amino acids)

>Shewana3_3332 branched-chain amino acid transport system II carrier protein (RefSeq) (Shewanella sp. ANA-3)
MQDNQMSIGDTLGLGFMTFAFFLGAGNLIFPPFAGMLAGENMPLAMLGFLITAVGLPLVG
LIAVAKAQGKVMAMLPVFAATALAIAIYIIIGPAFAAPRTGLVAYEIGAKPFIDNTTATI
MLGSLSLNLSQLIYTLCFFTVTMLLALFPGKLLDSVGKVLTPILLLLLVGLALSVVFLPA
GDVGAAVGDYQNHPLTKGILEGYNTMDTLASLMFGMLIIDLLRKKGIDQPSAQTKYLIRA
AFIAAAGLAFVYVSLFFLGATAGDIAVGAKNGGEILTNYVTREFGSLGTVLLSTVVTLAC
LTTAVGLVSACSEFFNELMPKLSYRFLVVLLSAICALIANVGLSQLITISIPVLMAVYPV
AIALVAVTFLTEYFPRPQFAHRAALSVALLFGIFDGMKVAAKSLTGEDGKGVTEAAQSFI
DLVSGMSPTLSILPLYEEGMAWLLPTLVVIVLCLIIRGSGAKTVSAA