Protein Info for Shewana3_3300 in Shewanella sp. ANA-3

Annotation: chromate transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 78 to 107 (30 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 178 (32 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 259 to 276 (18 residues), see Phobius details amino acids 287 to 309 (23 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details amino acids 347 to 365 (19 residues), see Phobius details amino acids 372 to 389 (18 residues), see Phobius details PF02417: Chromate_transp" amino acids 9 to 176 (168 residues), 134.4 bits, see alignment E=2.1e-43 amino acids 221 to 383 (163 residues), 110.3 bits, see alignment E=5.2e-36 TIGR00937: chromate efflux transporter" amino acids 15 to 383 (369 residues), 276.5 bits, see alignment E=2.6e-86

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 100% identity to shn:Shewana3_3300)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0F5 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Shewana3_3300 chromate transporter (RefSeq) (Shewanella sp. ANA-3)
MHRKAKHMLQIFLRFLTLGLMSFGGPAAHIGYFRQTFVNELGWLDDKRYASLVALSQFMP
GPGSSQVGFAIGYHRGGLLGAIAAFAGFTLPSFVLMYLLAITTAAWLGNDYMQGIVHGLK
LLAVVVVADVVLAMFSQFCQRKTARLLMLGSAASILIFPFLWTQIALLILAALLGLSFLS
ATESESQKPEPIRLNYLSLGIFIALFVGSFFALDLGVEAGIFGEFYRTGSLVFGGGHVVL
PLLETAVGDSLSSDRFLTGYAFAQAVPGPMFTFATFLGAEMMLDNPFVGAVIATLAIFLP
GFLLMLVGLKSWHAIAARPKIAGMLAGVNACVVGLLAAALYQPVFTQGVLSGVDMAIVLL
GFGALKLFKPQMLLLVLGFSLCGIGLILLG