Protein Info for Shewana3_3279 in Shewanella sp. ANA-3

Updated annotation (from data): Vitamin B12 transporter, permease component (fecCD-like)
Rationale: This protein is cofit with the B12-dependent methionine synthase MetH and is FecCD-like. It probably works with Shewana3_3280 (ABC transporter domain protein with similar phenotypes) and Shewana3_3272 (periplasmic binding protein). This protein is similar to SO_1033 which is also involved in B12 uptake (it is strongly cofit with metH; also see PMCid:PMC3219624)
Original annotation: transport system permease protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 25 to 52 (28 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 291 to 315 (25 residues), see Phobius details amino acids 328 to 347 (20 residues), see Phobius details amino acids 356 to 374 (19 residues), see Phobius details PF01032: FecCD" amino acids 36 to 376 (341 residues), 281.6 bits, see alignment E=3.6e-88

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to shn:Shewana3_3279)

Predicted SEED Role

"ABC transporter (iron.B12.siderophore.hemin) , permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0D4 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Shewana3_3279 Vitamin B12 transporter, permease component (fecCD-like) (Shewanella sp. ANA-3)
MIDTLKLVTMNFFSHIFTPLTRQQWLILGLAGFALLTPIAAASFGAANISFLDVLQVFIN
KLSHLFMADEAVSTSMTERIVMELRLPRIILAFVAGAGLSLAGSVLQTVTRNPLADPYLF
GISSGASFGAVVMLTLFTGSGLFGNAGTIANSGIFSGSGTFAGLLWFSLPFGAFIGASLS
VLIVLALAGLGLKSQVERMLLSGVATSFMFSALTSLLLYFASPQATASVLFWSLGSFAKA
SWSLLVLPSLVVLLSFFIILGWKRQIMALQAGDETAHTLGVNVPKLRLNMLLLCSLITAI
LVATCGGIGFVGLMIPHTVRLLFPGRQPILLTALVGGLFMVWIDVLARCLLGNQELPVGI
ITAAIGSFFFLLILRRRKLSN