Protein Info for Shewana3_3276 in Shewanella sp. ANA-3

Annotation: adenosylcobinamide kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF02283: CobU" amino acids 4 to 196 (193 residues), 174.4 bits, see alignment E=7.5e-56

Best Hits

KEGG orthology group: K02231, adenosylcobinamide kinase / adenosylcobinamide-phosphate guanylyltransferase [EC: 2.7.1.156 2.7.7.62] (inferred from 100% identity to she:Shewmr4_0844)

Predicted SEED Role

"Adenosylcobinamide-phosphate guanylyltransferase (EC 2.7.7.62)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.7.7.62)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.156 or 2.7.7.62

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0D1 at UniProt or InterPro

Protein Sequence (200 amino acids)

>Shewana3_3276 adenosylcobinamide kinase (RefSeq) (Shewanella sp. ANA-3)
MIHLVLGGARSGKSRYGEALVRQYTALGFDACYLATAQALDAEMSSRIRLHQDGRAKDDI
DWQLVEEPLALTAKLKHLAKPGRVILVDCLTLWLTNQLLAQSPEAEPASTESDFALDFAL
SRHEPLEHWRQQRADFIQTLSTLEGVVILISNEVGSGIVPLGELSRQFVDEAGWLNQAVA
EVADNVTLVVAGLPLVLKSS