Protein Info for Shewana3_3234 in Shewanella sp. ANA-3

Annotation: heme utilization protein HuvX (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 TIGR04108: putative heme utilization carrier protein HutX" amino acids 24 to 177 (154 residues), 188.9 bits, see alignment E=2.5e-60 PF06228: ChuX_HutX" amino acids 40 to 177 (138 residues), 125.2 bits, see alignment E=1.8e-40 PF05171: HemS" amino acids 45 to 173 (129 residues), 33.6 bits, see alignment E=3.3e-12

Best Hits

KEGG orthology group: K07227, hypothetical protein (inferred from 100% identity to shn:Shewana3_3234)

Predicted SEED Role

"Putative heme iron utilization protein" in subsystem Iron acquisition in Vibrio

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L089 at UniProt or InterPro

Protein Sequence (188 amino acids)

>Shewana3_3234 heme utilization protein HuvX (RefSeq) (Shewanella sp. ANA-3)
MTQTIDTEITLPSHHTDADSQSMLRQRFVRQPDLMPAQLASELGIAELDVVAALPQAQRV
FLSLTQIDELLQSLPEWGPLTTIVMLSGSVFEFKGDFPQGKFAHGYYNLYSKGDGLHGHL
KLDNMRAIALISRPFRGSESHSINFFGPQGEVVFKVYLGRDKQRVLFPEQVSRFKTLAST
FATQQSPI