Protein Info for Shewana3_3232 in Shewanella sp. ANA-3

Annotation: lipid ABC transporter ATPase/inner membrane protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 transmembrane" amino acids 51 to 71 (21 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 164 to 188 (25 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details TIGR02204: ABC transporter, permease/ATP-binding protein" amino acids 35 to 608 (574 residues), 913.5 bits, see alignment E=2.8e-279 PF00664: ABC_membrane" amino acids 54 to 323 (270 residues), 152.3 bits, see alignment E=2.3e-48 PF00005: ABC_tran" amino acids 388 to 537 (150 residues), 112.6 bits, see alignment E=2.3e-36

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to shn:Shewana3_3232)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L087 at UniProt or InterPro

Protein Sequence (618 amino acids)

>Shewana3_3232 lipid ABC transporter ATPase/inner membrane protein (RefSeq) (Shewanella sp. ANA-3)
MNKQVTETTESSTLPPRSLSESTMSHNAANSSIRQRAVLPWIWQFLKPYRLRVVAAIVFL
LIGSLAWLSLGQGVRLMVDEGFIKDNAQRLNEIILLVLLITAVSGTAVFCRFYLMTWLGE
RVSADIRLTVYNQLLKLSPAFYAKVRTGEVISRFTADSTLLQTVVGSSLSMALRSGVTVI
GGLAMMGITSVKMTLLVLLAVPLVLGPVGFFGRKVRTLARESQDRVADLGAYVDETLHEI
HTVQAYGHEDKDRSLFNGRVEDVMIAASGRIRYRAMLISSVMFLSIAAIASVTWVGAHDV
MSGKMTGGELSAFMFYAVMVAGAVATISEVVGEIQRASGAAERLIELAETEVDIPAPLEP
KTLPAKVRGELQLQQLNFHYPEQTQLVLRDLELTITAGERVALVGPSGAGKSTLFQLLQR
FYVPSSGSIHLDGIDIAELSPKDLRAQFALVPQDSVIFATSVLENVRYGRVDASEQEVID
ACIAARAHEFISEFSEGYQTYLGERGVRLSGGQKQRIAIARVILADRPILLLDEATSALD
ALSEQKVKLALDELMKGKTTLIIAHRLATVINADRIIVFDKGRIVASGKHQTLIQTNALY
REFASLQLLTDEVSALSE