Protein Info for Shewana3_3228 in Shewanella sp. ANA-3

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 54 to 72 (19 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 49 to 476 (428 residues), 515.9 bits, see alignment E=4.7e-159 PF12801: Fer4_5" amino acids 102 to 134 (33 residues), 30.2 bits, see alignment (E = 1.4e-10) PF13746: Fer4_18" amino acids 227 to 329 (103 residues), 129.8 bits, see alignment E=2.3e-41 PF11614: FixG_C" amino acids 363 to 477 (115 residues), 102.6 bits, see alignment E=6.7e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3228)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L083 at UniProt or InterPro

Protein Sequence (477 amino acids)

>Shewana3_3228 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MPKSDPLQSENAKRSSAEQFIPVKNIQADDKPAHKSSGQIHFREQKGYFQRLRTTMNSLL
VLLFFALPFISFDGRQAILLDVSQQQFFFFGLTLWPQDFTLLAWVFIAAAFGLFFITVFW
GRVWCGYLCPQTAWTFMFVWLESRIEGNSNKRKLLDKAPWSANKLGKRSLKHGLWGLAAL
ITGCGFIGYFIPARELYLDIFTGNAGFWTTCWVWFFAICTYLNAGWMREQMCLHCCPYAR
FQAVMFDANTKTVTYDAARGEARGPRKRKQPTELGDCVDCNLCVEVCPTGIDIRQGLQYE
CINCGACVDACNETMQKFDYKQNLISYVSESELKGIAHSNWRSPRFLGYGAAVVIMLVVI
GLDLSSRSEIQLNVIRDRQSLYRETADNKVENTYQLKIRNKTQQTKQYQLAVNSEMPFSL
IADPVITLAPGEQSDYPVTVLADKDAIPAGRKIIEFSVTDVSKPEQSVSQETGFFSP