Protein Info for Shewana3_3215 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 57 to 76 (20 residues), see Phobius details amino acids 84 to 110 (27 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details PF12821: ThrE_2" amino acids 12 to 147 (136 residues), 124.8 bits, see alignment E=1.4e-40

Best Hits

Swiss-Prot: 53% identical to Y1443_PROMH: UPF0442 protein PMI1443 (PMI1443) from Proteus mirabilis (strain HI4320)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3215)

Predicted SEED Role

"FIG001826: putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L070 at UniProt or InterPro

Protein Sequence (157 amino acids)

>Shewana3_3215 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MIALLWTLLHDAFFSAIPAVGFAMVFNVPKRFLPYCALAGAIGHSSRTLMLQFGLPIEWA
TFAAAALVGTITIGFAKRHLAPPLMYAVAAIIPMIPGTYAFNTVIALVQLTAQSQVSQEL
TGQVISNGLKTVFILGALSVGLALPSLLYFRTRPVIQ