Protein Info for Shewana3_3214 in Shewanella sp. ANA-3
Annotation: dihydrofolate reductase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to DYR3_SALTM: Dihydrofolate reductase type 3 (dhfrIII) from Salmonella typhimurium
KEGG orthology group: K00287, dihydrofolate reductase [EC: 1.5.1.3] (inferred from 100% identity to shn:Shewana3_3214)MetaCyc: 56% identical to dihydrofolate reductase (Escherichia coli K-12 substr. MG1655)
Dihydrofolate reductase. [EC: 1.5.1.3]
Predicted SEED Role
"Dihydrofolate reductase (EC 1.5.1.3)" in subsystem Folate Biosynthesis (EC 1.5.1.3)
MetaCyc Pathways
- superpathway of chorismate metabolism (51/59 steps found)
- folate transformations II (plants) (11/11 steps found)
- folate transformations III (E. coli) (9/9 steps found)
- superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
- dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
- tetrahydrofolate biosynthesis I (3/3 steps found)
- superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.5.1.3
Use Curated BLAST to search for 1.5.1.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0L069 at UniProt or InterPro
Protein Sequence (160 amino acids)
>Shewana3_3214 dihydrofolate reductase (RefSeq) (Shewanella sp. ANA-3) MRIAMIAAMANNRVIGKDNKMPWHLPEDLRHFKAMTLGKPVVMGRKTFESIGRPLPGRHN IVISRQADLQIEGVTCVTSFEDAKLAAGDCEELVVIGGGQLYQQLLPQADRLYLTQINLE VEGDTFFPAWDSDKWQETESLTSINADGLEYRFINLAKKC