Protein Info for Shewana3_3212 in Shewanella sp. ANA-3

Annotation: methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 673 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details PF00672: HAMP" amino acids 349 to 392 (44 residues), 24.4 bits, see alignment 3e-09 PF00015: MCPsignal" amino acids 483 to 639 (157 residues), 142 bits, see alignment E=1.7e-45

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to shn:Shewana3_3212)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L067 at UniProt or InterPro

Protein Sequence (673 amino acids)

>Shewana3_3212 methyl-accepting chemotaxis sensory transducer (RefSeq) (Shewanella sp. ANA-3)
MKVNVATRVIGGFSVVTLLLVLLGFTSYLTNISLKDSSAMMQELSLPALKATNHLTETLS
EQQRQVLIAYHAPKSSNIPDIRKVFNDHGTQFKNEISNLTQLVQGQANLSALISQLDGSF
STFERDSLAMLTEREAALSKQEQLIGLKKKLENAADDASSVLLDIIDLENSQNPDAQSIA
ASASAIDTSMGNIITTIADLVTNEEMSKHELISKELDYILSETKNKLEYVNRHAQDIIDA
DTLKSVNEDTKKVLALLEGPDSMVLLKATQLNHAKSAMNQLATIEKDVKVIDRNMEDVSN
NIESVAANMSQETIAKIDAASIRTIIVVLIAIVAAVIISFAVVAPLKRSLYQVNNALNVL
ASGNLTHKLDDSGHDEFAELAKNCNRLVDSLRGLIVGILDRSNQLAAAAEQTSAITAQTT
SGIQEQKSQVDQVATATTELSSSAQQVSMSADDALAQIKQADQEAKHMRTIAEENKRTIL
ALADEVAKAGQVINKVQSDSASIGSILDVIRGIAEQTNLLALNAAIEAARAGEQGRGFAV
VADEVRSLASRTQVSTREIQQMIEVLQQGAQQAVAAMDMGRAQANACVDKTEQANLALET
ISQSVHKAYDAGTHIAHAAQEQNVVSQQVSEKLEHIAAISEETAIGADQTAQSSHQVAKL
AEELQASVGEFRV